PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_2467_iso_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 350aa    MW: 37996.6 Da    PI: 10.103
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_2467_iso_4genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.57.4e-14129173347
                                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                          +WT+eE++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
  cra_locus_2467_iso_4_len_1379_ver_3 129 PWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 173
                                          7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.5651932IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129415.96122178IPR017930Myb domain
SuperFamilySSF466891.12E-16124179IPR009057Homeodomain-like
TIGRFAMsTIGR015574.6E-16125177IPR006447Myb domain, plants
SMARTSM007172.2E-9126176IPR001005SANT/Myb domain
PfamPF002495.0E-11129173IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-11129173IPR009057Homeodomain-like
CDDcd001672.93E-9129173No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MSSSLERKKG KTVIMLRSCS QCGSNGHNSR TCGESSSAAG NGAGDGEFML FGVRVKVDPM  60
RKSVSMNDLS QYELPSNVNQ NGVDNSKNSN DSDKVVADDV VTAGAGYVSA DDAVQHQSTG  120
GRERKRGIPW TEEEHKLFLL GLQKVGKGDW RGISRNFVKT RTPTQVASHA QKYYLRKNNL  180
NRRRRRSSLF DITTDSVPGG LPMDDVKNHQ DKSVPKVLQH SQVPHAEKPN MNGYTIAPFP  240
LAVGPILLPV QVHNPMENKA FHWGDHQLQN GPGMLLRTVP FIPVANSSSA IRDLNLNQRV  300
EGEPSSPLSL KLSLSSSDNS QSSSTRHSTG FQAMAATSFS KGGDSIISVA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071772.19e-88PREDICTED: transcription factor MYB1R1
SwissprotQ2V9B03e-82MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA1DR860.0A1DR86_CATRO; MYB transcription factor
STRINGVIT_01s0026g01050.t012e-86(Vitis vinifera)
Publications ? help Back to Top
  1. Vom Endt D,Soares e Silva M,Kijne JW,Pasquali G,Memelink J
    Identification of a bipartite jasmonate-responsive promoter element in the Catharanthus roseus ORCA3 transcription factor gene that interacts specifically with AT-Hook DNA-binding proteins.
    Plant Physiol., 2007. 144(3): p. 1680-9
    [PMID:17496112]